DPCstruct | MC8123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 154 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0Q6U0 | 9-171 | IPELQLVRAMAILAVLMVHATSYATVQLTNSSLYVVYNALNVLMKYGTPVFIALSSMVLFYNYKDRPMGRQLLSRFYKQRLLYILLP… |
| A0A8B1B7Q1 | 1-157 | MPWIDAARVISIFAVVFLHISASVVTEADFGSSFWWHGNFYDSMVRWCVPVFVMISGALLLDESRVEDAVTFYKRRVGRLLLPLIFW… |
| A0A7V4QBT5 | 1-173 | None |
| A0A2U1S6E1 | 3-159 | None |
| A0A373PPG5 | 6-150 | None |
| A0A329UKM9 | 14-167 | None |
| A0A485AMM7 | 1-151 | None |
| A0A1Y3NPH8 | 95-250 | None |
| A0A447JAI1 | 1-151 | None |
| A0A2R4CFI3 | 21-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.