DPCstruct | MC8122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9PBR6 | 7-99 | LNALSQEALYKNWLTSRCIGKSTDSERTKQDAFRSASAYLELSKLPMDAFEQGEKLAEQYANKNSQGSVQGTYHTLDCLSLQNASEA… |
| A0A809E835 | 2-110 | VLATCIANAYRSDKDAAEDAGSSVSALRDWTRCNMEKSPDAVRSLVDRYLARNQANPLADAEIKGLRFDFLKCLDLYHSPELAALAR… |
| A0A0S7ZYR3 | 29-120 | None |
| A0A7W8WPH9 | 171-281 | None |
| A0A2N9Y6W2 | 8-121 | None |
| A0A2N6QI44 | 77-203 | None |
| A0A4V3C8X4 | 1-108 | None |
| A0A7T7Q704 | 2-101 | None |
| H8L5E5 | 40-137 | None |
| A0A847MLM9 | 41-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.