DPCstruct | MC8120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 140 ± 23 aa |
| Standard deviation of domain lengths | 23.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2WK41 | 2-104 | SKKNLEAMVASATAAAKGAEALGAQAMAFSKKNIEDQMAAAKSLSSAKSLQEAMELQTAYTKSALETYMAEMSKMSEIVTASMKDSM… |
| A0A8A5XQW5 | 11-146 | AAAEKVNIMISDFNDRAKAAFEKTAKAGEELGEFTKGNFEAFATSAKTAAKGAESLGQELADYGKKSFESASATIKSLAAVKTPTEL… |
| A0A2U1WN20 | 10-153 | None |
| A0A7Y9SV65 | 145-334 | None |
| A0A257YEK6 | 158-312 | None |
| A0A7T2GK14 | 4-190 | None |
| A0A3D2VWS0 | 10-148 | None |
| A0A839SNF2 | 31-174 | None |
| A0A1L6J9J0 | 88-233 | None |
| A0A543KHZ5 | 80-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.