DPCstruct | MC812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 394 ± 41 aa |
| Standard deviation of domain lengths | 40.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150GHD2 | 12-398 | CDTPDPLLAYSAACTDMLMSGCEPWRDFCSAETAAAAQVLCLAPKDRTPAATTTPTAAGTALPPPADPCVLDSSQPSCKSYRYPDSA… |
| A0A150GP60 | 1-327 | MPGCTVKEACESRSVTGAFCAPFSLLASICADMPGMGGCRAYRTLCANGTAVRQCTEYPAIPGLPTTKQAGAAVDAMCASMYMTQCD… |
| A0A507FL88 | 2-394 | None |
| A0A146HTT1 | 291-694 | None |
| A0A1Y2H9U7 | 1-423 | None |
| F4PZ12 | 11-361 | None |
| A0A0L0RUT7 | 124-534 | None |
| A0A2R5G0G1 | 66-423 | None |
| A0A7S0UU77 | 176-541 | None |
| A0A2P6V3Q1 | 709-1157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.