DPCstruct | MC8118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 148 ± 22 aa |
| Standard deviation of domain lengths | 21.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3QGN1 | 10-145 | PLIAVIVSKYISYEIQKRNDKLDLFKTLMATRENPATMEYTNAVNSIDIIFYQNNDILTAWKNLYNEYSSKDPNYNLIIQYRTKLLE… |
| A0A2V1HIM9 | 29-212 | TDWTKLVVSLKDWAPWVTVIATALSPLIAVQVTRFIDSKKEIYKKKEDIFTTIFALRNGNPNDYNYFTRLNLIPVYFMNEKKVIDSF… |
| A0A6N2X1L2 | 2-132 | None |
| A0A519SXD1 | 21-154 | None |
| A0A1S1MX75 | 9-139 | None |
| A0A1E3M1W4 | 13-161 | None |
| A0A2T7GAY6 | 3-175 | None |
| A0A315XX47 | 1-169 | None |
| A0A386HSW2 | 37-199 | None |
| A0A844B639 | 12-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.