DPCstruct | MC8117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369BNX2 | 112-197 | EKLTLEKVLELSHKGQELSWNDFKSYDSTEIGSGLYILRYEIDESYYLLIGGNNPRKKPAYIRLVKADNSEKYIDIRENNVEEFIS |
| W4EIS5 | 20-108 | CTACQSHKEPGTSGYISLNELESLADKGAALNWSDFDKYTYEDIGSGVYIRKYEIEGEGQLLVRGKSLEKPPEQISIVDQKGGEQDV… |
| A0A1K1WFH8 | 198-276 | None |
| A0A1K1NF82 | 508-613 | None |
| W7YP35 | 1-79 | None |
| A0A1K1MZW0 | 30-126 | None |
| A0A0L6JXE0 | 60-152 | None |
| A0A1M7HVB3 | 60-145 | None |
| A0A4S2HQ66 | 398-496 | None |
| A0A1D3TTW5 | 217-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.