DPCstruct | MC8116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 147 ± 23 aa |
| Standard deviation of domain lengths | 23.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G9FYR2 | 6-142 | KAYDKAKWHFESIEKEGLDEIQAYVHTAFFWRWIVDQNLTDKRFEEDFEDDFSAYRNGSIDALEFYRVLDGCLIGDMMNDEGNAFAS… |
| W4E979 | 2-153 | AYDRIDWHSGGDYPADLPEENGGIHIGMFLAWALGRGMAGEIHLEESAEALKRLKRRELTGLEYLLEYCDGKFWDEDLDERGNAFAA… |
| R7FE42 | 218-385 | None |
| A0A2E9EAR4 | 1-106 | None |
| A0A4Q3AZW4 | 2-149 | None |
| Q2N9V9 | 1-147 | None |
| A0A385SS99 | 127-272 | None |
| A0A1V4G491 | 89-231 | None |
| A0A806TH65 | 47-190 | None |
| A0A806TIT3 | 31-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.