DPCstruct | MC8114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0ICN4 | 1-89 | MSSRRSRQHSGSTRISDDQIIELVSKLRQLVPEIRNRRSDKVSASKVLQETCNYIRSLHREVSDLSERLSQLLTTIDADSAEAGIIR… |
| A0A6J0K866 | 1-90 | MSNRRSRQSTSAPRISDDQIIDLVTKLRQILPEIGQRGRSDKVSASKVLQETCNYIRNLNREVDNLSERLAQLLESVDENSPEAAVI… |
| A0A7J7MYX4 | 1-83 | None |
| A0A2R6PBF3 | 75-156 | None |
| A0A426ZDY1 | 105-194 | None |
| A0A834ZRA7 | 1-72 | None |
| A0A3P6BKX1 | 76-166 | None |
| A0A6L2JAC6 | 39-124 | None |
| A0A7J0GAH4 | 1-80 | None |
| A0A1U7WQN4 | 26-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.