DPCstruct | MC8112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 148 ± 8 aa |
| Standard deviation of domain lengths | 7.90 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A643BZ33 | 313-452 | AGEPEPLTEKALREASSAVDVLGEALVAGAYSKTWSHREDALLALYKQLMDAPAATPKEDLKSTLRAAVFLIRRAIRDIVTPVFQAS… |
| A0A1B0D0L6 | 177-325 | RGKFKVMNDREKRQAALPLLVFGTELVELFYSKQFQDREEGLTRLRNILRNPTVIEGTIGPNKVARSSTLLLYRAVRDAVFSVFSQA… |
| A0A383W6W3 | 501-639 | None |
| A0A7R9FVQ2 | 362-514 | None |
| A0A821MQJ7 | 517-656 | None |
| A0A7M5X2P3 | 427-579 | None |
| A0A0M4E377 | 251-417 | None |
| A0A813Z7U6 | 348-492 | None |
| A0A811WGB4 | 463-602 | None |
| A0A6I9VMF5 | 43-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.