DPCstruct | MC8111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 57.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01480 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482WFK6 | 4-64 | LGKEVTHKMKSARMAKLMELGIKADVDLLEYIMLMISNKRTKAGMIRDLSLFLGSSTTIFV |
| A0A0D6LJB2 | 1-74 | MAVGQNLDVSKKLKAAIKAKLEELGVYVDDELPEYIMVMIANKKEKNQMKDDLNLFLGKCTNKFVDWLVFVIYL |
| A0A6V7XAT9 | 2-71 | None |
| A0A1B6L2Y8 | 1-64 | None |
| A0A7J7IUX4 | 7-66 | None |
| G3V2X4 | 1-63 | None |
| F6R442 | 1-63 | None |
| A0A0B1TD39 | 1-65 | None |
| A0A0N4VG19 | 28-86 | None |
| A0A834XZJ4 | 5-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.