DPCstruct | MC8110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 103 ± 21 aa |
| Standard deviation of domain lengths | 20.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 92.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.30 |
| Pfam Score | 95.73 |
| Assigned Pfam label(s) | CL0374- PF17297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6R3G414 | 133-234 | CMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGSAVLDALGAGEFIKGLHSVGCPLPLKKPLVNNWACNPELTLI… |
| A0A0D6LJ80 | 6-101 | NGYVIPFCLGPIGGRYSINAVQLTDSAFVVLNMRVITRVSSAIWDAIGQADFVRCIHSVGRPRPITARLKSNWMCNTDQYFLAQRLA… |
| A0A820YIV3 | 151-216 | None |
| A0A4W2GN71 | 218-283 | None |
| A0A452T4U6 | 120-266 | None |
| H2YVS0 | 144-255 | None |
| A0A6G3UZ62 | 2-67 | None |
| A0A2C9K0Q4 | 6-107 | None |
| A0A2C9K1J6 | 2-96 | None |
| A0A6A8AX61 | 76-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.