DPCstruct | MC811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 155 ± 29 aa |
| Standard deviation of domain lengths | 28.69 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821C6G7 | 8-145 | KCSKLDNEARQREEFTKYKLLLKQLKKSEADYKDDAKIAFLLQQEDIQYLVENIWGSNSALSACDDLYELAMVRWNKYYEWSPWNCI… |
| A0A150GP14 | 27-185 | PALFGMAAAGFVLCALAGPEHEVHGEPIIRLTALQYERALQRLQERERARFGTDEGVGVDLDEVAYLLREVWRGFSATDPHRVVPPG… |
| A0A834XNF3 | 886-1004 | None |
| A0A7S2JMR3 | 85-259 | None |
| A0A1X7T844 | 136-261 | None |
| A0A195BBT4 | 401-548 | None |
| A0A2G8S614 | 140-306 | None |
| H2YGU7 | 332-445 | None |
| A0A1R1X876 | 2-144 | None |
| A0A2R5G9L2 | 235-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.