DPCstruct | MC8109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 12.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455B1Q3 | 1-103 | MTATAQAPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQ… |
| A0A2K6SB95 | 1-122 | MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSA… |
| A0A7R8X2Q8 | 3-107 | None |
| E7FBG0 | 1-131 | None |
| A0A3Q2QMM1 | 1-122 | None |
| A0A835NSL9 | 227-362 | None |
| A0A7R8W9K1 | 1-111 | None |
| A0A7R8VT12 | 197-308 | None |
| A0A0K2TSM8 | 48-180 | None |
| A0A485MWF0 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.