DPCstruct | MC8107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HFU0 | 1-97 | MSPEASRYCALFEMTECGFERKLADDEYPHALYIQNYSSAASSCILLRKWIFDNDREIELCERDRLFKELCFWQAVAGVNGGLVSAK… |
| A0A0D6L9Z8 | 1-117 | MSRDMALSCAIFETMEQSFERKLLDGESPHQLYIQNYSCASSSCLVLRKWIFDPDRERQLCQKDPLFRQFVFHQAVADVNEGRLKCC… |
| A0A7R9J5R7 | 45-141 | None |
| A0A0R3RFC7 | 457-553 | None |
| A0A6J2K6N9 | 227-337 | None |
| A0A4Z2BM93 | 1-113 | None |
| A0A6J0JAM0 | 47-150 | None |
| A0A6A4W7D2 | 210-319 | None |
| G0PN95 | 102-211 | None |
| A0A7J5XS81 | 124-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.