DPCstruct | MC8106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 196 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812LLC5 | 2-202 | EAFQHFGESVEREDLEPFVQPMMEKLGSKLQGNVKRQKKAITFIAVIAGQVDDAFAPYYGHLMPLLKQVIENTLHKTEERQLLGKCF… |
| A0A2S3IJK5 | 490-679 | DILTPYLDGIVGKLLLLLQTGNQMVQEAALTALASAADSSQEHFQKYYDAVMPYLKAILMNATDKSNRMLRAKSMECISLVGMAVGK… |
| A0A2G5EE12 | 495-684 | None |
| A0A425DN20 | 16-207 | None |
| A0A2C9KRR0 | 114-295 | None |
| A0A0C3FI33 | 67-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.