DPCstruct | MC8105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6L742 | 1-96 | MADRFDFVLNEYRKLAGGEHVGFNNATFLSERDTADRNYALSYYMKENKCFPPGTQGLREELDLYFQLCSLETTCETAAVMAATLAN… |
| A0A7S1VH39 | 174-279 | LPLADRFKKLTSGFADLAGRQKVRFNQAVYLSEKNTAHRNFALAYFMKRFNAFPEHVNFLEAVDFYFQSCSIDVTCDKLAAMASTFA… |
| E4YCI2 | 69-188 | None |
| A0A4Z2J2K1 | 260-372 | None |
| A0A183QVA5 | 21-120 | None |
| A0A834AQT0 | 14-129 | None |
| A0A183CN21 | 2-107 | None |
| E3NM55 | 40-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.