DPCstruct | MC8104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 433 ± 40 aa |
| Standard deviation of domain lengths | 40.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182EJT9 | 2-427 | HYVRSPCQGSDQAIAMALSIIWLIIPHVHGLYFKDLKQTLKKEQCDQALMITANVPSAKKIIIHGPDSSSGGIPSQFPIHEDTQFQQ… |
| A0A0D6L4P3 | 82-460 | GFVMHYVRAQCEGADKALGMALSLTWILAPNVHGLYFKDLKQTLKKEQCDQALMITANVPSAKKIIVHGPDSGMGGIPSQFPVHEDT… |
| A0A1S3QIA9 | 2-446 | None |
| A0A177B7Z4 | 191-654 | None |
| A0A131ZU79 | 196-638 | None |
| T2M9T4 | 505-978 | None |
| A0A182EDI4 | 2-427 | None |
| A0A821CUD4 | 3-515 | None |
| A0A238BTX2 | 458-840 | None |
| A0A1U8CUW3 | 2-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.