DPCstruct | MC8103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 169 ± 39 aa |
| Standard deviation of domain lengths | 39.03 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 37.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SQU6 | 25-200 | FYDFPFHPLVLDHTTFLLYCKLAEQRTKCYVEQCKDSSADTVFSPSNFICSFKRSHFTEVRQCLADAEPITFLKCDHQCHDEVVRTS… |
| A0A016X1A2 | 3-119 | VSCDHQCHDEVVRSNSKENDNGMNQVFSSTDLTRYEKELGMLCSFQTCYLQCMIPIVDEVCVPEMAQKTVDLVRSFVHWHATDISDW… |
| A0A2A6CMK5 | 263-479 | None |
| A0A4U5NHZ6 | 52-269 | None |
| A0A5S6PEY2 | 1-226 | None |
| J9EGT3 | 5-108 | None |
| A0A2A2KKQ7 | 22-173 | None |
| G0PMH2 | 12-174 | None |
| A0A1I7S2E4 | 132-293 | None |
| A0A238C0H1 | 23-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.