DPCstruct | MC8102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1S9N0 | 230-303 | DTSTQQQIMCDCCICNESVSQRKCCSTSERRETNLLLISCLVMSKSLGLERARSAYSKIARARCSVCKGHYTYA |
| A0A016WUV0 | 1-86 | MATTVLHFRDIFFFMKIFRKCVICGDRREQSLLRMTWKSRPQLALLLALLIHSDDIDVERAKAVLRSSTEMKKGKYYCREHSEKAV |
| W2T712 | 253-331 | None |
| A0A368G4A1 | 1-84 | None |
| A0A368G491 | 356-459 | None |
| A0A368G0Z5 | 28-122 | None |
| A0A3P7M6B3 | 92-170 | None |
| A0A3P7KGE1 | 1-73 | None |
| A0A016UIW8 | 201-298 | None |
| A0A7I4YXB9 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.