DPCstruct | MC8101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 200 ± 24 aa |
| Standard deviation of domain lengths | 23.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0I4N1 | 5-175 | NDYEQAENKLIADGIDNFLTMQESERYETANYVLEKSDNGEISISARDGDNENKLFTVDEGSTITNQLSAEQTEDFVTFAEKVNEAA… |
| A0A846GDI7 | 15-215 | LGSIESNSDSEQQQKLVEEVAPNLERLLIEFDTDKIEGTNNTVEFNREENRLTLVSNSSKEIVLDAEWDTEQDRWNDRGSSLTTEER… |
| A0A6L9ZDM4 | 37-230 | None |
| E0UM94 | 210-391 | None |
| A0A1U7IFK9 | 394-579 | None |
| A0A0S3UEG1 | 416-619 | None |
| A0A0S3U6J4 | 540-696 | None |
| A0A6M0FS42 | 207-409 | None |
| A0A218QVT2 | 1-195 | None |
| A0A3B8JKW2 | 535-782 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.