DPCstruct | MC810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 118 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 15.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15868 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9WAQ0 | 43-157 | FLITHPSLRINSLQKQITTRYVLGVKGEDDHLLAQFADTLEYPAKKDVSVDLRYPEKDGITGDILTYIEIETLQDNEDGNAYVVSGG… |
| A0A7G3B7P8 | 24-138 | FFLSVIIFGLFVAAVVGQRWIGIGERQPGETLLGFIEDSSISDTPQNHTFQLFYQGVPGNVISYVHVNIDPKYSQLQFPVLGQFYDF… |
| T1GYW6 | 2-137 | None |
| A0A2W1BTW4 | 141-258 | None |
| A0A821VRA0 | 4-107 | None |
| A0A834XVE0 | 144-260 | None |
| A9XXB1 | 1-104 | None |
| A0A6J1PLH7 | 13-119 | None |
| A0A7E5VNQ2 | 52-172 | None |
| A0A6J1WSR8 | 27-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.