DPCstruct | MC81
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365NC03 | 13-117 | VTNTDVPPPRDWTNVYDEIGGDMRWNDDLEEMIKDRGLDGDVQPLYGTCSYTGEAMFLMQVGGKDFFFWNALDDSMYRVNGNLTLEK… |
| A0A0K8LJQ0 | 178-290 | YTINGRITEGIPKGWTNDPQFFEGFFDYDSAEAHLARRHGINDPKLLLMTTPDTGDMGYIITSGGRFYWGDLMIDHIAEITKPRTWP… |
| A0A0F0IMP3 | 1-105 | None |
| A0A505I2N8 | 4-115 | None |
| A0A2V5I5E1 | 11-148 | None |
| A0A0M8N3Q4 | 10-130 | None |
| A0A319AHP7 | 6-112 | None |
| A0A1L9WHY6 | 61-166 | None |
| A0A1V6R340 | 82-216 | None |
| A0A1L9UU35 | 19-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.