DPCstruct | MC8097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 336 ± 67 aa |
| Standard deviation of domain lengths | 66.77 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 29.46 |
| Pfam Score | 91.03 |
| Assigned Pfam label(s) | PF14577- PF14576 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3M2V0 | 27-247 | AWSDDKILETVYITHVHTGERYDVESLFSLTSNILRRSTAIADSVASKTGTPTVGLIEDKVPLSGYEPPFRKLKQISSQMMSTPLGE… |
| A0A833TFR4 | 28-351 | HVPVPNQNIPSSDLFDAIKSSLYLATQIVDNALLGAGGLENLEVPAVSTSGDLSLLPGILDQLSTVLRRSAPCGETELKNTSMSILR… |
| A0A6N2NJX7 | 29-462 | None |
| A0A2P5DXR8 | 13-247 | None |
| A0A2P5ECP3 | 10-434 | None |
| A0A2P5BWQ0 | 29-385 | None |
| A0A1U8M3V0 | 18-376 | None |
| A0A4S4F356 | 1-393 | None |
| A0A6A3ANR9 | 78-483 | None |
| A0A2N9GCH8 | 14-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.