DPCstruct | MC8092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3BAW0 | 4-80 | AYLFGCIISVIVASIVGEKLTDDECHQIGYNPSELYCNRCNELTKFELDSLKDSCMKCCRQDDSNSKKYSFARLEYC |
| A0A2I0MDX8 | 44-118 | MFHYNNYQISVYGTQLSSEACRELGFSSNLLCSSCNLLGQFNLNQLDPFCRQCCQEEAQLETRKLYAGAVLEVCG |
| E9FRE1 | 5-83 | None |
| A0A7J7N2V0 | 2-85 | None |
| A0A7R9QNV2 | 1-76 | None |
| H0Z7F2 | 94-169 | None |
| K7FGQ8 | 1-67 | None |
| A0A7N4P329 | 2-94 | None |
| A0A3M6URQ9 | 7-73 | None |
| A0A3B3IT39 | 14-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.