DPCstruct | MC8091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 83 ± 16 aa |
| Standard deviation of domain lengths | 15.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.98 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0083- PF20635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821TMY4 | 1-58 | MEELLGKFQDRYPTYQKRAQIPLCDIGERCAMKQGPRIGKLCDCSRGSSCNSFLLKCI |
| A0A2I0M5G7 | 67-138 | KVTEFQLSVADGRGLEVLEKLKSKRVPHYEKKFGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKC |
| A0A6J2HI51 | 143-209 | None |
| A0A1A8A1M4 | 79-163 | None |
| A0A452IMM9 | 1-111 | None |
| A0A437CWW0 | 97-178 | None |
| A0A6P8TB71 | 1-97 | None |
| A0A6I8PJX0 | 383-486 | None |
| G1T6C3 | 208-288 | None |
| A0A3B3BVU6 | 144-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.