DPCstruct | MC809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 688 ± 63 aa |
| Standard deviation of domain lengths | 63.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4W426 | 7-553 | ERPTPTPQARAWGGVRFSTPTFEVQSFFERLHDVHTHGRGRSRQSRLRFVDVLGAGWLHGEKSPALLSVAISPDVRAVNVTGSLSDG… |
| A0A7G3B5E5 | 1-764 | MEFAPNVGILVLGTLHAVGSSNGEIIMRPIARQTAELNRIERSLENLVVHDSIRLCTNRNCSYDENEIDPTHQGFLEYFNHTTLQWV… |
| A0A7E4S383 | 423-1101 | None |
| J9EUU5 | 1-667 | None |
| A0A0M3INI1 | 2-645 | None |
| A0A0N5CR55 | 204-984 | None |
| A0A238C4N5 | 518-1211 | None |
| A0A1I8EUZ8 | 13-706 | None |
| A0A183A883 | 3-742 | None |
| A0A5J4NTP3 | 6-670 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.