DPCstruct | MC8089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 42.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5KXD1 | 17-138 | GKGAACLSCKGICSGFLPHSWRKACTQCGCSVEDHGQSSDLEDDHKMGRLLADSKYVHLTAKVKGIRVYKRNRMVITNPVVSRKDPT… |
| A0A2I0LUC3 | 7-128 | VQKMSVSQPPSGRAVPCLRCRGTCTGFEPHSWRKICKSCKCSQEDHSLSSDVEDDRKIGRLLSDSKYATLTARVKGGDGVRIYKRNR… |
| A0A3Q1GGX5 | 1-110 | None |
| A0A7R9AYH8 | 4-142 | None |
| A0A6P8T3R6 | 4-114 | None |
| B7Z5L5 | 17-128 | None |
| A0A673ACY7 | 38-137 | None |
| A0A673ADP9 | 6-123 | None |
| A0A4Z2BAS6 | 2-95 | None |
| A0A2U4C424 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.