DPCstruct | MC8088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 294 ± 26 aa |
| Standard deviation of domain lengths | 25.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 46.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0LQ30 | 1-303 | MFHPRPFVKTRFAPQGAVACIQAISTFYYTIAFRIHAEFQLNEPPHFPFWFSPGQFTGHIILSKDSSHVREFKLFVPNNRSLNVDME… |
| A0A7D9DIK5 | 222-548 | MFHPRPFLYSRFPPQGAVACVRAENEKFLEIEFRLHAEFQLNTPPLLPFWFTPAQFSGRLIISKDGSHIHHFEMEVPCNKTLNVDME… |
| A0A2K5F960 | 206-442 | None |
| A7S7Z1 | 156-453 | None |
| A0A4Y2LCR1 | 201-474 | None |
| A0A091E5A4 | 140-461 | None |
| A0A226MY62 | 129-430 | None |
| M7BAW2 | 486-791 | None |
| A0A818FKQ4 | 1-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.