DPCstruct | MC8086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 15.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B9X131 | 2-121 | EHKWCYSYNGENFTGSLNTKDEAINEAIREYGSEHKVLYVGQSVDPSTHVSVDGLMDSMYESVTEQCGDYAESFLYQVDENHQAVLE… |
| A0A072YLV6 | 5-130 | KCEEWIAEITDIDSEIWNSDIEGDIRKEVIKEGMKMAKEEGLVTFRIGRKIPVGIPSLDVDNILEDTYNQVYDEVGEVAESFLEDIT… |
| A0A542MA45 | 40-162 | None |
| A0A1M2Z3X8 | 239-396 | None |
| A0A5C8AD24 | 206-345 | None |
| A0A248UI24 | 88-242 | None |
| A0A257YLW7 | 9-155 | None |
| G2IZ23 | 52-208 | None |
| A0A3D5LBD2 | 88-205 | None |
| A0A3P3DHH6 | 5-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.