DPCstruct | MC8085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 18.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05431 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B9STH7 | 1-166 | MVADHIPVSQRIKESPYYILAKKQFWKRLWNDTFIPGEYLEFKEITGMSTTEQQSMTQTTNISLQADFGFAFKALTLGLGASISRSI… |
| A0A6I9Q8C4 | 228-376 | FVKEKASFEEQMNLSMLYEMTLDQFWEEVYTRENSHGKGKVVEVNSSIRAEMVFLNGREAKQDVERSVDGFLWFKPLDSMEEGIGLS… |
| A0A5A7SSK9 | 1-170 | None |
| A0A2S7PYC8 | 120-263 | None |
| A0A444ENM4 | 388-542 | None |
| A0A5J5AGE0 | 7-154 | None |
| B9G0W1 | 167-328 | None |
| A0A7G2DWJ0 | 214-385 | None |
| A0A0Q5NW98 | 270-414 | None |
| A0A2H5P3P0 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.