DPCstruct | MC8084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7KTH6 | 99-165 | ERVTLADCPIGLFLASSGALCLKTEYRNNEGRIDAYIVESGEFFWGGSPHSIPSQRRQMVTPVPLEQ |
| A0A2B9SNW6 | 1-66 | MKVRLADLEPGKLFRFGDTIGFKSEYRTGGAIEAFIVGSGEMFWGGTSTAKEQRELMVEPIELKDL |
| A0A560IPY3 | 3-72 | None |
| A0A7G2LS88 | 1-78 | None |
| A0A661ZVL9 | 7-70 | None |
| A0A679K062 | 5-75 | None |
| A0A6M3XRQ2 | 29-84 | None |
| A0A328ABX2 | 57-133 | None |
| A0A1H7ZA79 | 39-111 | None |
| A0A109GK63 | 29-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.