DPCstruct | MC8083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4LJY8 | 75-159 | GWDADAWGEAMDKYWDEYEELGTGPDARGPRLLMIEEEPQNGLWRVRQTFADPNGDHDWGISAEVDLAASDAEGRAVVKVTAVGQ |
| R5ZM35 | 24-107 | IRWQKALDAYHEQHEEILTDGDARSAAMFSIDESNEKTDHVWHVHQIFADEDGDHDFGIMGDVDLDATQDGGEVIFKNYRVGFI |
| A0A7V9LPC3 | 1-61 | None |
| A0A7C7UM08 | 14-98 | None |
| A0A7X9Q2V8 | 171-253 | None |
| A0A1P8Y9W4 | 127-210 | None |
| A0A0R2XL96 | 111-209 | None |
| A0A7C1UIF7 | 2-75 | None |
| A0A1V5KQ00 | 29-113 | None |
| A0A7C6R7X7 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.