DPCstruct | MC8082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 171 ± 25 aa |
| Standard deviation of domain lengths | 25.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.41 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | PF02508- PF04205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316NKV8 | 30-211 | VMALVMIFVENMIFTRALGTSTALVIIRKKNNLLVFGLILTLITVFSGIVTWFMQPVLEDLPNANYYRPLIYAAVISLVYLLALVIC… |
| A0A417D4R4 | 5-161 | PFLGVSKTTDTAAGMGGAVIFVITLSSFVTSVIYKLILQPLDLTYLQTIVFILIIAALVQFVEMFLKKSMPSLYKALGVYLPLITTN… |
| A0A829YNY2 | 25-219 | None |
| A0A4P0Y3R3 | 23-167 | None |
| A0A7H4P9P7 | 12-165 | None |
| A0A1H7FDF7 | 19-218 | None |
| A0A6C1RI43 | 13-194 | None |
| A0A353MLM5 | 4-170 | None |
| A0A0A2WJB3 | 178-339 | None |
| A0A7X9A8N5 | 10-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.