DPCstruct | MC8081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 465 ± 104 aa |
| Standard deviation of domain lengths | 103.52 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317TIK3 | 266-847 | VTLNLDNVEFDKKPIGKEIIGAIQNRLDNNISKVDIEEFANAVALEGRTFKAAAIKGKLSKDWLSEDIFAIDIDNKHVEMYYKNIEN… |
| A0A417CWH3 | 70-526 | TLLVLEFDGDLKYREFKEKCEKYSLSYAFTYKTLGSCANQKGFGAVFLMDRWIKNPALAKAANILLRAFFSPVGAECLNLGRYFLGG… |
| A0A517DQI6 | 1-309 | None |
| A0A2D9FVD3 | 1-337 | None |
| A0A414B6Q2 | 2-433 | None |
| A0A3B9IY74 | 1-439 | None |
| A0A1F8ULV0 | 7-559 | None |
| A0A1G6TXD1 | 2-483 | None |
| A0A7X9XE60 | 165-811 | None |
| A0A317TMW7 | 1-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.