DPCstruct | MC8080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14190 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316S436 | 175-246 | LTVDLHEVCEKDCSYVDTNHHGRKILSWILESGLGEMTGEISRNGYCTYEMVHFNPERLKYFDPEGYRRYET |
| A0A417CU08 | 1-93 | MVKKKDQEEELYDILTVSLPGENIKINEAFITDFECKYKLQFIRKYKLGEVLQRVGHSGFCDYRLVRFDLEKLAEYDREGIKKFLAE… |
| A0A413LJ00 | 45-114 | None |
| A0A3E2N9A5 | 45-120 | None |
| D4CRD9 | 1-79 | None |
| K1UEJ1 | 28-107 | None |
| A0A3R6PWV0 | 49-126 | None |
| A0A373GPX9 | 55-129 | None |
| A0A227LUR9 | 84-158 | None |
| A0A3D2M9T7 | 40-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.