DPCstruct | MC808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 763 ± 61 aa |
| Standard deviation of domain lengths | 61.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.58 |
| Pfam Score | 66.11 |
| Assigned Pfam label(s) | CL0287- CL0570- CL0015- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8SAU1 | 26-805 | YLSNEKLGECLNNLTKIHGNLAKLHSFGHSVQGRQIWALELSEDVGNRSLLKPMFKYVANIHGDETVGRELLYRLARYLLDNYSHDQ… |
| A0A7G3ARK3 | 115-819 | VNAYHSTEEINEWLYYLAEQYPEVQVIRGGSTFEGRDIIGININRKVDENPGIFIEANIHAREWITSGSTVWLINKLLTATDAEPAY… |
| A0A818AJ52 | 372-1178 | None |
| A0A0N5AFM4 | 57-894 | None |
| A0A0S7F421 | 50-774 | None |
| A0A6J0HRP2 | 249-973 | None |
| A0A6P4XY92 | 9-911 | None |
| A0A1A9ZI83 | 157-850 | None |
| A0A819D2S6 | 2-729 | None |
| T1L0V9 | 39-855 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.