DPCstruct | MC8077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 4 aa |
| Standard deviation of domain lengths | 3.78 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8XBD0 | 8-99 | TKIPVLFRKWPRLKGGGIIAIFPTELGTDDPHTSSMYEHVGQHGAGDTRDVVQRTKRATPSEYASLLKELHKIGYRGLVVVQKLQQS… |
| A0A417CCA3 | 1-86 | MLMQVLFRKDKYTNEVIAFLPEIPVNTGMIMSYMHIGQHDEAALSYYWDTVKANKEEYNDLYDELCEIYEEKLRIKQRINYDLLRD |
| C3R3F1 | 43-130 | None |
| A0A431ICD6 | 44-129 | None |
| A0A7S8IML2 | 77-172 | None |
| X0X8M0 | 1-93 | None |
| A0A0J8WLN3 | 2-89 | None |
| A0A3S3JXD7 | 38-129 | None |
| A0A1F6HAM5 | 1-83 | None |
| A0A6H1ZC30 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.