DPCstruct | MC8076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 12.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8IZX6 | 8-143 | SKWILTDDDCAQYVRNLDEFKGNVFELWQVCGVLDMFAVAHAFININDYSEDEIEDVLHYYSYENLDDFVQEISPATIERKADGTLD… |
| A0A417CC57 | 2-124 | REEWVCTDSDSSQYCKINSDGTYSFIEKVWLDTCKGDPGYPDKSYTVKTAFVDLDDYTEHEKECNISGYYDSIESLREIYDDYSDQI… |
| A0A0D7WYE6 | 81-197 | None |
| A0A2P8MBS0 | 9-113 | None |
| A0A2B8JAK5 | 1-131 | None |
| A0A2B8J933 | 12-129 | None |
| A0A415U0R2 | 55-170 | None |
| A0A2V3Y242 | 29-143 | None |
| A0A6M6DZH0 | 118-226 | None |
| A0A373CTS6 | 55-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.