DPCstruct | MC8072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 135 ± 20 aa |
| Standard deviation of domain lengths | 20.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1FG92 | 261-372 | PDIRPLAMSKIKDDLLKHLNLDVETYALMARETDIVYRWLVAEKQHLKQNCKGKRPYDWCDIVERSKDEAMKLVAQNATDQTAYYWG… |
| A0A7U2F199 | 138-256 | NSQPLTQSADKQVLFARLGLNEQVHKLLVQDAQMARDRLSADASNLTDQSRLSPYITAPYRWDEISETAKHRILSEVVGNASPDVKH… |
| A0A3D8S0J7 | 4-166 | None |
| A0A6A6CBR8 | 3-169 | None |
| A0A0F4GEQ7 | 50-196 | None |
| A0A2I0S0Q8 | 6-126 | None |
| A0A2I0RTI6 | 17-128 | None |
| A0A6A6BWF3 | 3-130 | None |
| A0A3D8Q5C8 | 1-146 | None |
| A0A6A6PYL6 | 4-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.