DPCstruct | MC8071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 128 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0TEI7 | 49-170 | VTFFRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVLATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSS… |
| A0A3B4FD18 | 75-212 | ESLASGRSPSRYATLTATFVFASRTILLSVISLLNEPNTFSPANVDASVMYRKWRDSKGKDREYVEIIRKQVLATKAEAERDGVKVP… |
| A0A654GUS5 | 18-145 | None |
| F7BVX7 | 333-455 | None |
| A0A821LYQ8 | 24-141 | None |
| A0A3L7I3E3 | 34-159 | None |
| A0A0R3UE78 | 1-160 | None |
| A0A5C6MRF7 | 321-450 | None |
| A0A061I260 | 787-910 | None |
| C3YBH3 | 95-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.