DPCstruct | MC8070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 109 ± 21 aa |
| Standard deviation of domain lengths | 21.18 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 37.16 |
| Pfam Score | 90.32 |
| Assigned Pfam label(s) | PF00184- PF00220- PF19318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6H0C8 | 4-87 | GGACMSCGPELSGQCVGPDICCGPFGCYMGTLESSICQKENESTHPCEIQGAPCGSRGQGNCVTDGICCDSGACSYNAKCKTNN |
| A0A3B4F8U1 | 2-115 | HVKNLGQGPKPSERKYKLRKPKNCMSCGPGDRGRCFGPSICCGEGLGCLLSSPETAHCVEENYLLTPCQAGGRPCGSEGGRCAASGL… |
| A0A1E1WVS0 | 1-106 | None |
| A0A267G698 | 63-165 | None |
| A0A1Y3BKM5 | 14-126 | None |
| A0A162S7M6 | 26-150 | None |
| G1SG33 | 1-135 | None |
| A0A0K0E2C0 | 11-111 | None |
| A0A1I8I0Z5 | 7-91 | None |
| A0A7R9LLX7 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.