DPCstruct | MC807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 48.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833VRU3 | 12-90 | TKILLSSTVMDMVTTNLQQQRQITEQLRREAALRRITVSKAVEDIMKYITEHEQEDYLLVGFSSQKSNPFRERSYCTIF |
| A0A7G3AGK6 | 66-142 | GLSETAVMDIMASNLQQQRAIVDQLRREASMQRIMVSQACVDIVKYVSEHEQEDCLLVGFSSQKVNPFREKSSCVVL |
| A0A1A9UVJ9 | 40-117 | None |
| T1JYW6 | 2-81 | None |
| A0A1I8H6A1 | 61-144 | None |
| A0A7I8V637 | 2-78 | None |
| A0A182YA45 | 2-69 | None |
| A0A834M752 | 39-118 | None |
| A0A183MTB6 | 189-263 | None |
| A0A5N5TDJ1 | 38-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.