DPCstruct | MC8069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 107 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 53.81 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF03623- CL0632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4F701 | 7-114 | PAPPEEYVPMVKDVGLALRTLLATVDETLPQLPASTHREIEMAQKLLNSDLAELIAKMKLAQQYVMTSLQQDYKKQMLTAAHALAVD… |
| V9IF93 | 157-254 | ADQYLELVRKVGIELRALLSSVDALMDILPISAHREVEMAHKVLSKDMAELVTAMKQAQKYSATTLDAEYRKGMLSAAHILAMDAKN… |
| A0A6G0HGH5 | 594-714 | None |
| A0A182GDL0 | 191-298 | None |
| A0A7J8IAS6 | 226-332 | None |
| A0A7R9QBS4 | 191-298 | None |
| A0A0M4E7E7 | 986-1091 | None |
| A0A1A6HTD4 | 508-607 | None |
| A0A7R8CUE1 | 277-384 | None |
| A0A034W2L1 | 319-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.