DPCstruct | MC8068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 89 ± 3 aa |
| Standard deviation of domain lengths | 2.81 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4F5I0 | 1-91 | QAKATTVGDALEKQSGEKLSEAKVVKLYGQIPPIEKMDSSLSTLMNCEQLSLSTNCIEKITNLNGLKNLKILSLGRNNIRLLTELLC… |
| A0A6J0GQM7 | 117-206 | MNKAKATTIKEALAKWEEKNGQKASEAKEVKLYGQVPPVEKMDESLSTLVNCEKLSLSTNCIERIANLNNLKNLRILSLGRNNIKNL… |
| A0A6B0RRZ0 | 313-400 | None |
| A0A4W2ERC1 | 259-350 | None |
| A0A7J6LRF1 | 1-83 | None |
| A0A819MZA4 | 1-90 | None |
| A0A2P6U0T2 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.