DPCstruct | MC8067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4UFW5 | 292-373 | PFWKNAIDWLDEGRNGVVGVVPDLDQAFNLFRESKFNCRKTNFSEDLSVFVCTAYSDQHVEEIQNFVAEGGGLLIGGHAWHW |
| A0A3B4F276 | 1-82 | MAPFWRNAIHWLDEGRRGVVGVMVDPALKVLSKSGLKCEKTNFRKDLSVFVCTAYITEHLEEIQNFVAEGGGLLIGGHAWWW |
| A0A5F4WEL4 | 1-85 | None |
| G3HL41 | 61-145 | None |
| A0A498M250 | 67-164 | None |
| A0A7J5YFU7 | 144-225 | None |
| A0A6I9Z4X1 | 509-595 | None |
| A0A3Q2D5L8 | 345-423 | None |
| A0A2E7ZQD0 | 214-301 | None |
| A0A6I9Z2P9 | 326-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.