DPCstruct | MC8065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1228 |
|---|---|
| Mean domain length (aa) | 147 ± 26 aa |
| Standard deviation of domain lengths | 26.36 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.37 |
| Pfam Score | 85.41 |
| Assigned Pfam label(s) | PF12535- CL0063- CL0536- CL0110- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P0XWF0 | 17-194 | GAVIGANVHIGPFCIVGANVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTV… |
| A0A6G3NS57 | 31-179 | TSAGDPEARRAALAELLGELGEGAEIRPPLRVDYGHRITVGPRTFVNFGAVFLDVARITIGADVQMGPNVQLLTPTHPIDPEPRRAK… |
| A0A381E381 | 67-202 | None |
| A0A5S6QLD8 | 675-787 | None |
| A0A7J0G0H9 | 89-237 | None |
| A0A819MZI3 | 121-336 | None |
| A0A4V1XW52 | 576-712 | None |
| A0A543NTB1 | 435-581 | None |
| A0A7R9UEV4 | 173-305 | None |
| A0A2R6EAE3 | 33-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.