DPCstruct | MC8064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 45 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415IMU3 | 10-46 | PGVCRICGCTENDPCFHPDHGTCWWADESQTICSHCA |
| A0A1X0WP38 | 2-48 | AEKSHCKICGCTWNNACYTSDKGACWWIDEEETMCSHCYYGWNGEIE |
| A0A3P3T9U6 | 11-62 | None |
| A0A4Y9J9I8 | 1-48 | None |
| A0A1H9G3I2 | 3-50 | None |
| A0A1X1G0R4 | 2-47 | None |
| A0A4Y8KV12 | 1-45 | None |
| A0A1B8WGV3 | 4-53 | None |
| A0A380K1Q2 | 2-46 | None |
| A0A2V3ZRR7 | 84-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.