DPCstruct | MC8063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 288 ± 23 aa |
| Standard deviation of domain lengths | 22.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.69 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0361- CL0459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077YWV1 | 20-291 | EEAKRFEYWIIEKGGIVSIFLDGSESVIVTDDPLYNKYREKIVSYLVQHPTSKLFFKLPAPLREAIRAKVPIVSKDEFKQYVEKVDP… |
| A0A4E9F881 | 1-307 | MAENTTAQPSTSLSFFSDSFIIKRGKKPLHSMEFILDLEDENSRLQLERDIKFLGGKVLESLDDDGEKPFCVVTDHPHARYLERVTK… |
| Q283Q6 | 6-301 | None |
| A0A0P4WG40 | 31-330 | None |
| A0A2P8Y579 | 1-280 | None |
| A0A1X0RIC6 | 68-362 | None |
| A0A7M5WST2 | 13-280 | None |
| A0A7J7U7G8 | 2-266 | None |
| A0A665UK32 | 2-315 | None |
| A0A3S3PSZ8 | 2-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.