DPCstruct | MC8062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8M3I7 | 1-85 | MASINSTLTLTRYKSPLPPNVIISGSKLGFAKLQHANLGALVGPENGGYYLKYPEGKVVAVANDQLCSIIDKKFLSLIFHLEREG |
| A0A5N6VWN6 | 1-76 | MSTTRYKDPIPEGVCVFTTLDEAAQIQKANPYAIFYPENNGHYAKDPDGTVVAVASDETCEEIDRRNAELEAKIAA |
| A0A5M3YZF3 | 18-112 | None |
| A0A2B7YC65 | 2-91 | None |
| A0A507QMX3 | 14-103 | None |
| I8A3S6 | 51-144 | None |
| A0A370PX21 | 311-392 | None |
| A0A6V8H7H0 | 6-83 | None |
| A0A5N6FG04 | 1-86 | None |
| A0A5N6X7T7 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.