DPCstruct | MC8061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 225 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7TYP8 | 3-228 | PSVQHWPGGIPSSIKPHPETDLSLDQLKEEVKGWLLFVQETWVPAANTATSNDGQYELHQRRYLIEQWASATQDFRDSYQSRAPMPE… |
| B8M1K0 | 1-213 | MANSPSRPFHWPGGILPEVRLDPNGDIKPDEVKEEAKGWLLFVTERWVSREAPNIPDHDGDYEVRQRRTLVETWAKADQQFRDSYHQ… |
| A0A093Y8U6 | 79-316 | None |
| A0A318Y7K2 | 9-227 | None |
| A0A194W333 | 49-265 | None |
| A0A317W758 | 1-217 | None |
| A0A100IPJ3 | 757-984 | None |
| A0A1S9RP93 | 326-564 | None |
| A0A1V6Q3F6 | 590-794 | None |
| A0A364KQU8 | 5-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.